PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G019700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 320aa    MW: 34989 Da    PI: 9.3299
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G019700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.79.3e-53131421129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhP+d+el+++yL++kv+gk  ++  +  + +vd++kvePwdLp +++ + kewyfFs rd+kyatg+r+nrat sgyWkatgkd
  Brast10G019700.1.p  13 LPPGFRFHPRDDELICDYLAPKVTGKVgFSGRRPpMVDVDLNKVEPWDLPVAASVGGKEWYFFSLRDRKYATGQRTNRATVSGYWKATGKD 103
                         79************************986665656***************8888899********************************** PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         + v + +g+lvg++ktLvfy+grapkg+kt+Wvmheyrle
  Brast10G019700.1.p 104 RVVAR-RGALVGMRKTLVFYQGRAPKGRKTEWVMHEYRLE 142
                         *9999.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.02E-593166IPR003441NAC domain
PROSITE profilePS5100555.87613166IPR003441NAC domain
PfamPF023651.2E-2714141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MSMSFLSMVE GELPPGFRFH PRDDELICDY LAPKVTGKVG FSGRRPPMVD VDLNKVEPWD  60
LPVAASVGGK EWYFFSLRDR KYATGQRTNR ATVSGYWKAT GKDRVVARRG ALVGMRKTLV  120
FYQGRAPKGR KTEWVMHEYR LEGAHEQASK FTSKQEDWVL CRVICKKKLA VGATSKPRNL  180
TTIGHGTSTD TSSPPLPPLM DTTLAQLHAT MNNTSATAAA AATLEQVPCF SSFNNNSASN  240
SSTAQPCYLP MVTGNNGMNY MDHGLPDFGS YLDPASMNCD KKVLKAVLSQ LSSMGGEVMP  300
SLLPPEMAAS VSSSWMNHF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-50916711169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010237041.10.0PREDICTED: NAC domain-containing protein 21/22-like isoform X1
SwissprotQ84TE61e-87NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLI1IGK00.0I1IGK0_BRADI; Uncharacterized protein
STRINGBRADI4G02060.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100223144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.26e-78NAC domain containing protein 1